DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Sox15

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:91 Identity:27/91 - (29%)
Similarity:45/91 - (49%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMA------ 68
            |:||:|||:| :|..|:.:..::|.....|:|.:.|..|:.:.||.|..:.|.|.:..|      
Mouse    48 KRPMNAFMVW-SSVQRRQMAQQNPKMHNSEISKRLGAQWKLLGDEEKRPFVEEAKRLRARHLRDY 111

  Fly    69 -EYKEKLEKWNAFKEHQTESFPHIYE 93
             :||.:..:.:  |...|.|.|...|
Mouse   112 PDYKYRPRRKS--KNSSTGSVPFSQE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 21/73 (29%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45
HMG-box_SoxA_SoxB_SoxG 46..121 CDD:438837 22/73 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 7/27 (26%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181 27/91 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.