powered by:
Protein Alignment tHMG2 and hmg-6
DIOPT Version :9
Sequence 1: | NP_001163689.1 |
Gene: | tHMG2 / 42651 |
FlyBaseID: | FBgn0038979 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493451.2 |
Gene: | hmg-6 / 185946 |
WormBaseID: | WBGene00009827 |
Length: | 128 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 17/63 - (26%) |
Similarity: | 27/63 - (42%) |
Gaps: | 12/63 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 SAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEKLEK 76
||:.|:.........||. |..:..::|.|....|.::.:|.| || ||::.||
Worm 54 SAYALFFRERQSLEKRAA-PYATFGQISQKIARQWDSLTEEEK--------KA---YKQRCEK 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.