DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and egl-13

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001024918.1 Gene:egl-13 / 180833 WormBaseID:WBGene00001182 Length:470 Species:Caenorhabditis elegans


Alignment Length:64 Identity:20/64 - (31%)
Similarity:34/64 - (53%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            |:||:|||:|.....||.::| :||.....:|...|..|:.|::..|..:.|..|:....:.|:
 Worm   330 KRPMNAFMVWARDERRKILKA-YPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 19/63 (30%)
egl-13NP_001024918.1 HMG-box_EGL13-like 327..404 CDD:438848 20/64 (31%)

Return to query results.
Submit another query.