DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and hmg-1.2

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:90 Identity:24/90 - (26%)
Similarity:49/90 - (54%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESA-------SKA 66
            ||:.:|||..: :...|..|:|.|||:.|.:|:.:.|:||:.:..|.|.::::.|       :..
 Worm   135 PKRALSAFFFY-SQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADE 198

  Fly    67 MAEYKEKLEKWNAFKEHQTESFPHI 91
            |..||.:::|.:....:..::..|:
 Worm   199 MRNYKAEMQKMSGMDHYDDDNIHHV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 21/73 (29%)
hmg-1.2NP_001380090.1 HMG-box_HMGB_rpt1 44..112 CDD:438794
HMG-box_SF 124..202 CDD:469606 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.