powered by:
Protein Alignment tHMG2 and hmg-1.1
DIOPT Version :9
Sequence 1: | NP_001163689.1 |
Gene: | tHMG2 / 42651 |
FlyBaseID: | FBgn0038979 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370073.1 |
Gene: | hmg-1.1 / 175081 |
WormBaseID: | WBGene00001971 |
Length: | 95 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 18/63 - (28%) |
Similarity: | 29/63 - (46%) |
Gaps: | 5/63 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYK 71
||:.||||..||..... |.:.|...|.:|:...|..|..:.|:.: |::.|:.....|:
Worm 28 PKRAMSAFFFWMQENRE---RIKKPGMGVADVAKAAGVEWGKLTDKSR--WEKKAADDKKRYE 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.