DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Hmg20b

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001415470.1 Gene:Hmg20b / 15353 MGIID:1341190 Length:415 Species:Mus musculus


Alignment Length:80 Identity:22/80 - (27%)
Similarity:42/80 - (52%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||.|::.::.::|.. |:.||..|||....|::...|..|..:....|..:.:.|.|...:|.::
Mouse    70 PKAPVTGYVRFLNER-REQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKE 133

  Fly    74 LEKWNAFKEHQTESF 88
            |  | |::  |:|::
Mouse   134 L--W-AYQ--QSEAY 143

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 16/66 (24%)