DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and Hmgb1

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001300823.1 Gene:Hmgb1 / 15289 MGIID:96113 Length:215 Species:Mus musculus


Alignment Length:71 Identity:26/71 - (36%)
Similarity:42/71 - (59%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||:|.|||.|:. |..|..|:.|||..|:.:|:.|.||||...|.:.|..:::.|:|...:|::.
Mouse    95 PKRPPSAFFLFC-SEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKD 158

  Fly    74 LEKWNA 79
            :..:.|
Mouse   159 IAAYRA 164

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 25/65 (38%)
Hmgb1NP_001300823.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000269|PubMed:22842346 1..97 1/1 (100%)
Heparin-binding. /evidence=ECO:0000250|UniProtKB:P10103 1..10
LPS binding (delipidated). /evidence=ECO:0000250|UniProtKB:P09429 3..15
HMG_box_2 6..78 CDD:401091
NLS 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 26/71 (37%)