powered by:
Protein Alignment tHMG2 and LOC108350839
DIOPT Version :9
Sequence 1: | NP_001163689.1 |
Gene: | tHMG2 / 42651 |
FlyBaseID: | FBgn0038979 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017448593.1 |
Gene: | LOC108350839 / 108350839 |
RGDID: | 11440908 |
Length: | 214 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 28/67 - (41%) |
Similarity: | 37/67 - (55%) |
Gaps: | 5/67 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEKL 74
|:|.|||.|:. |..|..|:.|||..|:.:|:.|.||||...|.:.| :...|..|:.|||.
Rat 96 KRPPSAFFLFC-SEYRPKIKGEHPGLSIGDVAKKLGEMWTNTAVDDK----QPCEKKAAKLKEKY 155
Fly 75 EK 76
||
Rat 156 EK 157
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tHMG2 | NP_001163689.1 |
HMGB-UBF_HMG-box |
9..75 |
CDD:238686 |
26/64 (41%) |
LOC108350839 | XP_017448593.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.