DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and LOC108350839

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_017448593.1 Gene:LOC108350839 / 108350839 RGDID:11440908 Length:214 Species:Rattus norvegicus


Alignment Length:67 Identity:28/67 - (41%)
Similarity:37/67 - (55%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEKL 74
            |:|.|||.|:. |..|..|:.|||..|:.:|:.|.||||...|.:.|    :...|..|:.|||.
  Rat    96 KRPPSAFFLFC-SEYRPKIKGEHPGLSIGDVAKKLGEMWTNTAVDDK----QPCEKKAAKLKEKY 155

  Fly    75 EK 76
            ||
  Rat   156 EK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 26/64 (41%)
LOC108350839XP_017448593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.