DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and LOC103910042

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_009296780.2 Gene:LOC103910042 / 103910042 -ID:- Length:221 Species:Danio rerio


Alignment Length:75 Identity:22/75 - (29%)
Similarity:39/75 - (52%) Gaps:12/75 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKPMSAFMLWMNSTG-RKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            |:||:|||:|  |.| |:.:..|:|.....|:|.:.|..|:.::|..|..:.:.|.:..|::   
Zfish    15 KRPMNAFMVW--SRGQRRQMALENPKMHNSEISKRLGAEWKRLSDSEKRPYIDEAKRLRAQH--- 74

  Fly    74 LEKWNAFKEH 83
                  .:||
Zfish    75 ------MREH 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 20/65 (31%)
LOC103910042XP_009296780.2 SOX-TCF_HMG-box 13..84 CDD:238684 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.