DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and LOC103690904

DIOPT Version :9

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_008771804.2 Gene:LOC103690904 / 103690904 RGDID:9317736 Length:168 Species:Rattus norvegicus


Alignment Length:69 Identity:22/69 - (31%)
Similarity:43/69 - (62%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            |:||.|:|:|: :....:.|:.:||:::|.:|:...|.||...::..||.::|.|:...|:|.|:
  Rat    93 PRKPPSSFLLF-SQDHFEEIKEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEE 156

  Fly    74 LEKW 77
            .|.:
  Rat   157 REAY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 21/65 (32%)
LOC103690904XP_008771804.2 HMGB-UBF_HMG-box 9..76 CDD:238686
HMGB-UBF_HMG-box 95..158 CDD:238686 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.