DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG2 and HMG20A

DIOPT Version :10

Sequence 1:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_060670.1 Gene:HMG20A / 10363 HGNCID:5001 Length:347 Species:Homo sapiens


Alignment Length:80 Identity:20/80 - (25%)
Similarity:42/80 - (52%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73
            ||.|::.::.:||.. |:.:||:.|:....|::...|..|..:..|.|..:.:.|.:....|.::
Human   103 PKSPLTGYVRFMNER-REQLRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKE 166

  Fly    74 LEKWNAFKEHQTESF 88
            ||::     .:||::
Human   167 LEQY-----QKTEAY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 16/66 (24%)
HMG20ANP_060670.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 3/9 (33%)
DUF5401 <59..313 CDD:375164 20/80 (25%)
HMG-box_HMG20A 83..186 CDD:438833 20/80 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..211
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.