powered by:
Protein Alignment tHMG1 and ABF2
DIOPT Version :9
Sequence 1: | NP_651055.1 |
Gene: | tHMG1 / 42650 |
FlyBaseID: | FBgn0038978 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013788.1 |
Gene: | ABF2 / 855094 |
SGDID: | S000004676 |
Length: | 183 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 |
Identity: | 20/72 - (27%) |
Similarity: | 38/72 - (52%) |
Gaps: | 12/72 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAM--ADEDKIVWQESATTAMAEYK 70
||||...|:.:.|.. |..:.|:|||.|..::....|:.|::: :.:||.: .|||
Yeast 116 PKKPAGPFIKYANEV-RSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYI---------QEYK 170
Fly 71 EKLKQWN 77
:.::::|
Yeast 171 KAIQEYN 177
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I2725 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I1797 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.860 |
|
Return to query results.
Submit another query.