powered by:
Protein Alignment tHMG1 and IXR1
DIOPT Version :9
Sequence 1: | NP_651055.1 |
Gene: | tHMG1 / 42650 |
FlyBaseID: | FBgn0038978 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012893.3 |
Gene: | IXR1 / 853836 |
SGDID: | S000001515 |
Length: | 597 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 77 |
Identity: | 22/77 - (28%) |
Similarity: | 38/77 - (49%) |
Gaps: | 10/77 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
||:|...|:.:.... |..:..|:||..:.|::...||.||.:....|..:.|: ||::
Yeast 434 PKRPSGPFIQFTQEI-RPTVVKENPDKGLIEITKIIGERWRELDPAKKAEYTET-------YKKR 490
Fly 73 LKQWN--FPKEH 82
||:|. :|.|:
Yeast 491 LKEWESCYPDEN 502
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.