DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Tfam

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_112616.2 Gene:Tfam / 83474 RGDID:620682 Length:244 Species:Rattus norvegicus


Alignment Length:79 Identity:27/79 - (34%)
Similarity:42/79 - (53%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDCGARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATT-- 64
            |..|..||||||:::.:......| .||:|||..|.|:..|...|||.:.:.:|.|::.....  
  Rat    43 SSLGNYPKKPMSSYLRFSTEQLPK-FKAKHPDAKVSELIRKIAAMWRELPEAEKKVYEADFKAEW 106

  Fly    65 -----AMAEYKEKL 73
                 |:::|||:|
  Rat   107 KVYKEAVSKYKEQL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 25/73 (34%)
Herpes_U55 <55..>116 CDD:253772 7/26 (27%)
TfamNP_112616.2 NHP6B <46..215 CDD:227935 26/76 (34%)
HMG_box 49..116 CDD:395407 21/67 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.