DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and HMGB6

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_568431.1 Gene:HMGB6 / 832408 AraportID:AT5G23420 Length:241 Species:Arabidopsis thaliana


Alignment Length:109 Identity:30/109 - (27%)
Similarity:54/109 - (49%) Gaps:16/109 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDCGARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAM 66
            |....:||:|::||.::| |..||..|:||.....::.:..|||.|:::.:|:|.|:.:.|....
plant   109 SSTSNKPKRPLTAFFIFM-SDFRKTFKSEHNGSLAKDAAKIGGEKWKSLTEEEKKVYLDKAAELK 172

  Fly    67 AEYKEKLKQWNFPKEHRFSDTQCICSSNTNQCPTLFVYDTMDDS 110
            |||.:.|:..:..:|....:.|.               |.:||:
plant   173 AEYNKSLESNDADEEEEDEEKQS---------------DDVDDA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 23/65 (35%)
Herpes_U55 <55..>116 CDD:253772 12/56 (21%)
HMGB6NP_568431.1 HMGB-UBF_HMG-box 115..179 CDD:238686 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3425
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.