DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and HMGB5

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_195282.1 Gene:HMGB5 / 829709 AraportID:AT4G35570 Length:125 Species:Arabidopsis thaliana


Alignment Length:72 Identity:22/72 - (30%)
Similarity:38/72 - (52%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPD-FSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
            |||||.|.|.::::.. ||.....:|| .||..|....|:.|:.|.:|::..:...:.:...||.
plant    33 RPKKPPSPFFVFLDDF-RKEFNLANPDNKSVGNVGRAAGKKWKTMTEEERAPFVAKSQSKKTEYA 96

  Fly    71 EKLKQWN 77
            ..::|:|
plant    97 VTMQQYN 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 19/68 (28%)
HMGB5NP_195282.1 HMG-box_AtHMGB1-like 35..95 CDD:438821 16/60 (27%)

Return to query results.
Submit another query.