DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and HMGB5

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001329802.1 Gene:HMGB5 / 829709 AraportID:AT4G35570 Length:125 Species:Arabidopsis thaliana


Alignment Length:72 Identity:22/72 - (30%)
Similarity:38/72 - (52%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPD-FSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
            |||||.|.|.::::.. ||.....:|| .||..|....|:.|:.|.:|::..:...:.:...||.
plant    33 RPKKPPSPFFVFLDDF-RKEFNLANPDNKSVGNVGRAAGKKWKTMTEEERAPFVAKSQSKKTEYA 96

  Fly    71 EKLKQWN 77
            ..::|:|
plant    97 VTMQQYN 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 19/66 (29%)
Herpes_U55 <55..>116 CDD:253772 4/23 (17%)
HMGB5NP_001329802.1 HMGB-UBF_HMG-box 34..100 CDD:238686 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3425
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.