DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and 3xHMG-box2

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:71 Identity:20/71 - (28%)
Similarity:39/71 - (54%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKE 71
            :||||.|::.|: :...||.:..|.|..:...|:......|:.:::|:|.|:...|...|..||:
plant   378 KPKKPASSYFLF-SKDERKKLTEERPGTNNATVTALISLKWKELSEEEKQVYNGKAAKLMEAYKK 441

  Fly    72 KLKQWN 77
            :::.:|
plant   442 EVEAYN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 19/65 (29%)
Herpes_U55 <55..>116 CDD:253772 7/23 (30%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 20/71 (28%)
HMGB-UBF_HMG-box 139..203 CDD:238686
HMG-box 255..320 CDD:381793
HMGB-UBF_HMG-box 379..444 CDD:238686 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.