DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and 3xHMG-box1

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:74 Identity:22/74 - (29%)
Similarity:39/74 - (52%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKE 71
            :||||.|::.|:... .||.:..|||..:...|:......|..:.:|:|.|:...|...|..||:
plant   371 KPKKPTSSYFLFCKD-ARKSVLEEHPGINNSTVTAHISLKWMELGEEEKQVYNSKAAELMEAYKK 434

  Fly    72 KLKQWNFPK 80
            :::::|..|
plant   435 EVEEYNKTK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 20/65 (31%)
Herpes_U55 <55..>116 CDD:253772 8/26 (31%)
3xHMG-box1NP_192846.1 HMGB-UBF_HMG-box 130..193 CDD:238686
HMGB-UBF_HMG-box 246..309 CDD:238686
HMGB-UBF_HMG-box 372..437 CDD:238686 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.