DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and AT2G34450

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001031480.1 Gene:AT2G34450 / 818008 AraportID:AT2G34450 Length:152 Species:Arabidopsis thaliana


Alignment Length:88 Identity:29/88 - (32%)
Similarity:47/88 - (53%) Gaps:10/88 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDF-SVQEVSVKG-GEMWRAMADEDKIVWQESAT------- 63
            ||||.:||..:::.. ||..:.|:||. |::||..|. ||.|:.|..|:|:.:.:.||       
plant    63 PKKPATAFFFFLDDF-RKQYQEENPDVKSMREVIGKTCGEKWKTMTYEEKVKYYDIATEKREEFH 126

  Fly    64 TAMAEYKEKLKQWNFPKEHRFSD 86
            .||.||.::::.....:....||
plant   127 RAMTEYTKRMESGAHDESETDSD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 27/74 (36%)
Herpes_U55 <55..>116 CDD:253772 9/39 (23%)
AT2G34450NP_001031480.1 HMGB-UBF_HMG-box 63..129 CDD:238686 23/66 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3425
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.