powered by:
Protein Alignment tHMG1 and HMGB4
DIOPT Version :9
Sequence 1: | NP_651055.1 |
Gene: | tHMG1 / 42650 |
FlyBaseID: | FBgn0038978 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001031364.2 |
Gene: | HMGB4 / 816263 |
AraportID: | AT2G17560 |
Length: | 138 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 25/72 - (34%) |
Similarity: | 39/72 - (54%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RPKKPMSAFMLWMNSTGRKHIKAEHP-DFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
:||:|.|||.:::... ||.....:| :.||..|....|..|:||.||||..:...|.:...||.
plant 34 QPKRPPSAFFVFLEDF-RKEFNLANPNNKSVATVGKAAGARWKAMTDEDKAPYVAKAESRKTEYI 97
Fly 71 EKLKQWN 77
:.::|:|
plant 98 KNVQQYN 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
57 |
1.000 |
Domainoid score |
I3986 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm3425 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.820 |
|
Return to query results.
Submit another query.