DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tHMG1 and Hmgb4

DIOPT Version :9

Sequence 1:	NP_651055.1	Gene:	tHMG1 / 42650	FlyBaseID:	FBgn0038978	Length:	126	Species:	Drosophila melanogaster
Sequence 2:	NP_001102933.1	Gene:	Hmgb4 / 685271	RGDID:	1596426	Length:	181	Species:	Rattus norvegicus

Alignment Length:	62	Identity:	21/62 - (33%)
Similarity:	38/62 - (61%)	Gaps:	1/62 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
            |:||.|:|:|:......| :|.|:|:::|.:|:...|:||..:.|.||..:::.|....|:|
  Rat    93 PRKPPSSFLLFSLDHFAK-LKQENPNWTVVQVAKAAGKMWSMITDVDKRPYEQKAAIMRAKY 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tHMG1	NP_651055.1	HMGB-UBF_HMG-box	8..74	CDD:238686	21/62 (34%)
tHMG1	NP_651055.1	Herpes_U55	<55..>116	CDD:253772	4/15 (27%)
Hmgb4	NP_001102933.1	HMGB-UBF_HMG-box	9..75	CDD:238686
Hmgb4	NP_001102933.1	HMG-box	93..158	CDD:238037	21/62 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1641977at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.820