DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Hmgb4

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001102933.1 Gene:Hmgb4 / 685271 RGDID:1596426 Length:181 Species:Rattus norvegicus


Alignment Length:62 Identity:21/62 - (33%)
Similarity:38/62 - (61%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
            |:||.|:|:|:......| :|.|:|:::|.:|:...|:||..:.|.||..:::.|....|:|
  Rat    93 PRKPPSSFLLFSLDHFAK-LKQENPNWTVVQVAKAAGKMWSMITDVDKRPYEQKAAIMRAKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 21/62 (34%)
Hmgb4NP_001102933.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
HMG-box_HMGB_rpt2 92..160 CDD:438795 21/62 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.