DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and BBX

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_024309412.1 Gene:BBX / 56987 HGNCID:14422 Length:953 Species:Homo sapiens


Alignment Length:97 Identity:25/97 - (25%)
Similarity:44/97 - (45%) Gaps:26/97 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKH---IKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAE 68
            |.::||:||:|:.    ::|   ::.|||     .:..:|..  :.:||     |     .|:.:
Human    91 RARRPMNAFLLFC----KRHRSLVRQEHP-----RLDNRGAT--KILAD-----W-----WAVLD 134

  Fly    69 YKEKLKQWNFPKEHRFSDTQCICSSNTNQCPT 100
            .|||.|..:..||::  |.....:.....|||
Human   135 PKEKQKYTDMAKEYK--DAFMKANPGYKWCPT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 17/68 (25%)
Herpes_U55 <55..>116 CDD:253772 12/46 (26%)
BBXXP_024309412.1 SOX-TCF_HMG-box 91..162 CDD:238684 22/93 (24%)
DUF2028 203..>335 CDD:312980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.