DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hbp1

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001019602.2 Gene:hbp1 / 554137 ZFINID:ZDB-GENE-050522-414 Length:494 Species:Danio rerio


Alignment Length:102 Identity:28/102 - (27%)
Similarity:47/102 - (46%) Gaps:25/102 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GARP---KKPMSAFMLWMNSTGRKHIKAE----HPDFSVQEVSVKGGEMWRAMADEDKIVWQESA 62
            ||.|   |:||:||||:     .|..:.|    :|....:.:||..|:.|:.|.:|::.::...|
Zfish   408 GATPTKCKRPMNAFMLF-----AKKYRVEYTQMYPGKDNRAISVILGDKWKKMKNEERRMYTMEA 467

  Fly    63 TTAMAEYKEKLKQWNFPKEHRFSDTQCICSSNTNQCP 99
             .|:||.:::|            :..|.....||..|
Zfish   468 -KALAEEQKRL------------NPDCWKRKRTNSGP 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 21/72 (29%)
Herpes_U55 <55..>116 CDD:253772 9/45 (20%)
hbp1NP_001019602.2 AXH 210..328 CDD:285689
SOX-TCF_HMG-box 413..484 CDD:238684 22/88 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.