DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmgb3b

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001017769.1 Gene:hmgb3b / 550466 ZFINID:ZDB-GENE-050417-290 Length:198 Species:Danio rerio


Alignment Length:79 Identity:22/79 - (27%)
Similarity:43/79 - (54%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPDFSV--QEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
            :||..|||:..::.:...:|.| ::|..:|  .|.|.|..|.|:.|:.::|..:::.|....|.|
Zfish     8 KPKGKMSAYAYFVKTCREEHNK-KNPGVTVNFSEFSKKCSERWKTMSPKEKTKFEDLAKQDKARY 71

  Fly    70 KEKLKQWNFPKEHR 83
            .:::..:|..|:.|
Zfish    72 DQEMMHYNPGKKGR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 19/69 (28%)
hmgb3bNP_001017769.1 HMG-box_HMGB_rpt1 8..76 CDD:438794 19/68 (28%)
HMG-box_HMGB_rpt2 92..162 CDD:438795
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.