DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and sox7

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001016326.1 Gene:sox7 / 549080 XenbaseID:XB-GENE-488067 Length:362 Species:Xenopus tropicalis


Alignment Length:114 Identity:28/114 - (24%)
Similarity:53/114 - (46%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKE 71
            |.::||:|||:|.... ||.:..::||....|:|...|:.|:|::...|..:.|.|.....::.:
 Frog    41 RIRRPMNAFMVWAKDE-RKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQHMQ 104

  Fly    72 KLKQWNFPKEHRFSDTQCICSSNTNQCPTLFVYDTM--DDSMTPICRKC 118
            ....:.: :..|....:.||    .:..|.|:..::  |.:..|..|.|
 Frog   105 DYPNYKY-RPRRKKQIKRIC----KRVDTGFLLSSLSRDQNSVPDTRGC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 18/67 (27%)
sox7NP_001016326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41 28/114 (25%)
HMG-box_SoxF_SOX7 31..118 CDD:438849 20/78 (26%)
Sox17_18_mid 171..218 CDD:463454
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.