DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and tHMG2

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:133 Identity:95/133 - (71%)
Similarity:105/133 - (78%) Gaps:7/133 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDCGARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTA 65
            |||.|||||||||||||||||||||:|:|||||||||||||||||||||||||.||||||||:.|
  Fly     2 MSDYGARPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKA 66

  Fly    66 MAEYKEKLKQWNFPKEHRFSDTQCICS-------SNTNQCPTLFVYDTMDDSMTPICRKCLSKTR 123
            ||||||||::||..|||:......|..       |.|||.|||||||:.|::|.||||.|.||.:
  Fly    67 MAEYKEKLEKWNAFKEHQTESFPHIYEAPLSSRFSKTNQRPTLFVYDSKDEAMAPICRTCFSKAK 131

  Fly   124 CLH 126
            |.|
  Fly   132 CFH 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 60/65 (92%)
Herpes_U55 <55..>116 CDD:253772 38/67 (57%)
tHMG2NP_001163689.1 HMGB-UBF_HMG-box 9..75 CDD:238686 60/65 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467284
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0019459
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.