DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and D

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster


Alignment Length:74 Identity:21/74 - (28%)
Similarity:37/74 - (50%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73
            |:||:|||:| :...|:.|..::|.....|:|.:.|..|:.:|:.:|..:.:.|....|.:.   
  Fly   143 KRPMNAFMVW-SRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHM--- 203

  Fly    74 KQWNFPKEH 82
                  |||
  Fly   204 ------KEH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 18/66 (27%)
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 21/74 (28%)

Return to query results.
Submit another query.