Protein Alignment tHMG1 and sox17b.1

DIOPT Version :9

• Sequence 1: NP_651055.1
• Gene: tHMG1 / 42650
• FlyBaseID: FBgn0038978
• Length: 126
• Species: Drosophila melanogaster
• Sequence 2: NP_988849.1
• Gene: sox17b.1 / 394440
• XenbaseID: XB-GENE-484865
• Length: 376
• Species: Xenopus tropicalis
• Alignment Length: 73
• Identity: 19/73 - (26%)
• Similarity: 37/73 - (50%)
• Gaps: 1/73 - (1%)

  Fly     6 ARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
            ||.::||:|||:|.... ||.:..::||....|:|...|:.|:::....|..:.|.|.....::.
 Frog    56 ARIRRPMNAFMVWAKDE-RKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVEEAERLRVQHI 119

  Fly    71 EKLKQWNF 78
            :....:.:
 Frog   120 QDYPDYKY 127

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
tHMG1	NP_651055.1	HMGB-UBF_HMG-box	8..74	CDD:238686	17/65 (26%)
		Herpes_U55	<55..>116	CDD:253772	3/24 (13%)
sox17b.1	NP_988849.1	SOX-TCF_HMG-box	57..128	CDD:238684	18/72 (25%)
		PABP-1234	<80..250	CDD:130689	9/48 (19%)
		Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:O42601	327..331

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1641977at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010