DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and ubtfl

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_957297.1 Gene:ubtfl / 393978 ZFINID:ZDB-GENE-040426-1159 Length:719 Species:Danio rerio


Alignment Length:69 Identity:16/69 - (23%)
Similarity:34/69 - (49%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||.:...||.|...:.::|. ||:.|.:|:.......|..::|:.::.|...|......|::.
Zfish   198 PEKPKTPQQLWYNHEKKTYMKI-HPEVSQKELKEALRRQWSQLSDKKRLKWISKALELQKHYEDT 261

  Fly    73 LKQW 76
            ::.:
Zfish   262 MRAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 16/65 (25%)
Herpes_U55 <55..>116 CDD:253772 3/22 (14%)
ubtflNP_957297.1 HMGB-UBF_HMG-box 114..179 CDD:238686
HMGB-UBF_HMG-box 198..263 CDD:238686 16/65 (25%)
HMGB-UBF_HMG-box 299..359 CDD:238686
HMG-box 433..509 CDD:294061
HMGB-UBF_HMG-box 527..589 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.