DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and CG12104

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_647629.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster


Alignment Length:109 Identity:28/109 - (25%)
Similarity:40/109 - (36%) Gaps:23/109 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAW----PGNNNIYYICAAE------TVQGNRL-LRPRLYRCPANQMFVEGQC-VQRDWSNMPP 53
            :..|    ||.:::.|....|      ...||.| ..|..:...||.:|:|... |...:||   
  Fly    95 LVLWLNGGPGCSSVGYGATQEIGPFLVDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSN--- 156

  Fly    54 GTIVPYECVRPGLFADPAHCRYYYSCN-AELVATHLQCPEGTFF 96
             |...|:.:.....|..|   |.:.|| .|....|   .|.||:
  Fly   157 -TSSDYQKLGDDFTARDA---YTFLCNWFEKFPEH---KENTFY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 17/75 (23%)
CG12104NP_647629.1 HMG-box_SF 78..144 CDD:469606 11/48 (23%)

Return to query results.
Submit another query.