DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and ubtf

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001005395.1 Gene:ubtf / 368509 ZFINID:ZDB-GENE-030616-252 Length:735 Species:Danio rerio


Alignment Length:75 Identity:19/75 - (25%)
Similarity:40/75 - (53%) Gaps:3/75 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:|..:...||.:...:..:|| |||.:.:::....|:.|..::|:.:|.|...:......|:||
Zfish   189 PEKAKTPQQLWYSHEKKAFLKA-HPDATTKDIKDNLGKQWPQLSDKKRIKWIAKSLEQHKLYEEK 252

  Fly    73 LKQWNFPKEH 82
            :::  |.::|
Zfish   253 MRE--FIQQH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 17/65 (26%)
Herpes_U55 <55..>116 CDD:253772 7/28 (25%)
ubtfNP_001005395.1 HMGB-UBF_HMG-box 104..168 CDD:238686
HMGB-UBF_HMG-box 189..254 CDD:238686 17/65 (26%)
HMGB-UBF_HMG-box 292..351 CDD:238686
HMGB-UBF_HMG-box 400..463 CDD:238686
HMG_box_5 469..552 CDD:291548
HMGB-UBF_HMG-box 557..621 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.