DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Tox

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001102124.1 Gene:Tox / 362481 RGDID:1310455 Length:525 Species:Rattus norvegicus


Alignment Length:124 Identity:33/124 - (26%)
Similarity:56/124 - (45%) Gaps:28/124 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDCGARPK--------------KPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMAD 52
            ||.|.:||              ||:||:.|:...| :..||.::|:.:..|||.....||..:.:
  Rat   241 SDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDGLGE 304

  Fly    53 EDKIVWQESATTAMAEYKEKL---------KQWNFPKEHRFSDTQCICSSNTNQCPTLF 102
            |.|.|:::....|..||.::|         |.:|.|.:.:.|....:.:|.    |::|
  Rat   305 EQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYNDPVDVKTSQPPQLVNSK----PSVF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 23/88 (26%)
Herpes_U55 <55..>116 CDD:253772 13/57 (23%)
ToxNP_001102124.1 NHP6B <257..>360 CDD:227935 28/108 (26%)
HMG-box 261..>310 CDD:238037 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.