DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and sox4a

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_998287.1 Gene:sox4a / 336346 ZFINID:ZDB-GENE-030131-8290 Length:363 Species:Danio rerio


Alignment Length:67 Identity:23/67 - (34%)
Similarity:37/67 - (55%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTA----MAEY 69
            |:||:|||:| :...|:.|..:.||....|:|.:.|:.|:.:.|.|||.:...|...    ||:|
Zfish    65 KRPMNAFMVW-SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADY 128

  Fly    70 KE 71
            .:
Zfish   129 PD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 23/67 (34%)
sox4aNP_998287.1 HMG-box_SoxC 63..138 CDD:438838 23/67 (34%)

Return to query results.
Submit another query.