DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmg20a

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001082803.1 Gene:hmg20a / 326908 ZFINID:ZDB-GENE-030131-5107 Length:291 Species:Danio rerio


Alignment Length:99 Identity:26/99 - (26%)
Similarity:44/99 - (44%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDCGARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAM-----------ADED 54
            :.|..| ||.|::.::.:||.. |:.::||.||....|::...|..|..:           ||:|
Zfish    39 LKDSNA-PKAPLTGYVRFMNER-REQLRAERPDVPFPEITRMLGNEWSKLPADEKQRYLDEADKD 101

  Fly    55 KIVW-----QESATTAMAEYKEKLKQWNFPKEHR 83
            |..:     |...|.|...:..|:::....|.||
Zfish   102 KERYMRELEQYQKTEAYKHFSRKVQEKQKGKRHR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 21/81 (26%)
Herpes_U55 <55..>116 CDD:253772 8/34 (24%)
hmg20aNP_001082803.1 HMGB-UBF_HMG-box 45..110 CDD:238686 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.