DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and RGD1560585

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_006257666.1 Gene:RGD1560585 / 317597 RGDID:1560585 Length:168 Species:Rattus norvegicus


Alignment Length:65 Identity:23/65 - (35%)
Similarity:41/65 - (63%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||.|:|:|: :....:.||.:||:::|.:|:...|.||...::.|||.::|.|....|:|.|:
  Rat    93 PRKPPSSFLLF-SQDHFEEIKEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEE 156

  Fly    73  72
              Rat   157  156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 23/65 (35%)
Herpes_U55 <55..>116 CDD:253772 7/18 (39%)
RGD1560585XP_006257666.1 HMGB-UBF_HMG-box 9..76 CDD:238686
HMGB-UBF_HMG-box 95..158 CDD:238686 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.