DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Hmgb4l8

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_006257626.1 Gene:Hmgb4l8 / 317584 RGDID:1566225 Length:168 Species:Rattus norvegicus


Alignment Length:65 Identity:23/65 - (35%)
Similarity:41/65 - (63%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||.|:|:|: :....:.||.:||:::|.:|:...|.||...::.|||.::|.|....|:|.|:
  Rat    93 PRKPPSSFLLF-SQDHFEEIKEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEE 156

  Fly    73  72
              Rat   157  156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 23/65 (35%)
Hmgb4l8XP_006257626.1 HMG-box_SF 8..76 CDD:469606
HMG-box_HMGB_rpt2 95..161 CDD:438795 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.