Sequence 1: | NP_651055.1 | Gene: | tHMG1 / 42650 | FlyBaseID: | FBgn0038978 | Length: | 126 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359507.1 | Gene: | Tox2 / 269389 | MGIID: | 3611233 | Length: | 541 | Species: | Mus musculus |
Alignment Length: | 66 | Identity: | 20/66 - (30%) |
---|---|---|---|
Similarity: | 35/66 - (53%) | Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
Fly 73 L 73 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tHMG1 | NP_651055.1 | HMGB-UBF_HMG-box | 8..74 | CDD:238686 | 20/66 (30%) |
Herpes_U55 | <55..>116 | CDD:253772 | 5/19 (26%) | ||
Tox2 | NP_001359507.1 | HMG-box | 272..337 | CDD:238037 | 20/66 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |