DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tHMG1 and Ubtf

DIOPT Version :9

Sequence 1:	NP_651055.1	Gene:	tHMG1 / 42650	FlyBaseID:	FBgn0038978	Length:	126	Species:	Drosophila melanogaster
Sequence 2:	NP_001121162.1	Gene:	Ubtf / 25574	RGDID:	3927	Length:	764	Species:	Rattus norvegicus

Alignment Length:	69	Identity:	18/69 - (26%)
Similarity:	35/69 - (50%)	Gaps:	1/69 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||.:...||.....:.::|. .||.:.:||....|:.|..::|:.::.|...|.....||:|.
  Rat   196 PEKPKTPQQLWYTHEKKVYLKV-RPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEI 259

  Fly    73 LKQW 76
            ::.:
  Rat   260 MRDY 263

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tHMG1	NP_651055.1	HMGB-UBF_HMG-box	8..74	CDD:238686	18/65 (28%)
tHMG1	NP_651055.1	Herpes_U55	<55..>116	CDD:253772	5/22 (23%)
Ubtf	NP_001121162.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..21
		HMG_box	112..179	CDD:395407
		HMGB-UBF_HMG-box	196..261	CDD:238686	18/65 (28%)
		HMGB-UBF_HMG-box	299..358	CDD:238686
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	370..411
		HMGB-UBF_HMG-box	407..470	CDD:238686
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	456..488
		HMG_box_5	479..562	CDD:373364
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	546..576
		HMGB-UBF_HMG-box	569..631	CDD:238686
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	648..764
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900