DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Hmgb1

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_038945039.1 Gene:Hmgb1 / 25459 RGDID:2802 Length:486 Species:Rattus norvegicus


Alignment Length:68 Identity:29/68 - (42%)
Similarity:41/68 - (60%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            ||:|.|||.|:. |..|..||.|||..|:.:|:.|.||||...|.:||..:::.|    |:.|||
  Rat   366 PKRPPSAFFLFC-SEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKA----AKLKEK 425

  Fly    73 LKQ 75
            .::
  Rat   426 YEK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 29/65 (45%)
Herpes_U55 <55..>116 CDD:253772 6/21 (29%)
Hmgb1XP_038945039.1 HMG_box_2 277..349 CDD:401091
HMG_box 366..433 CDD:395407 29/68 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.