DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Hmgb1

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_037095.1 Gene:Hmgb1 / 25459 RGDID:2802 Length:215 Species:Rattus norvegicus


Alignment Length:68 Identity:29/68 - (42%)
Similarity:41/68 - (60%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            ||:|.|||.|:. |..|..||.|||..|:.:|:.|.||||...|.:||..:::.|    |:.|||
  Rat    95 PKRPPSAFFLFC-SEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKA----AKLKEK 154

  Fly    73 LKQ 75
            .::
  Rat   155 YEK 157

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 29/68 (43%)
Hmgb1NP_037095.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 2..97 1/1 (100%)
LPS binding (delipidated). /evidence=ECO:0000250|UniProtKB:P09429 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
Nuclear localization signal (NLS) 1. /evidence=ECO:0000269|PubMed:14532127 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 29/68 (43%)