powered by:
Protein Alignment tHMG1 and Hmgb1
DIOPT Version :9
Sequence 1: | NP_651055.1 |
Gene: | tHMG1 / 42650 |
FlyBaseID: | FBgn0038978 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038945039.1 |
Gene: | Hmgb1 / 25459 |
RGDID: | 2802 |
Length: | 486 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 29/68 - (42%) |
Similarity: | 41/68 - (60%) |
Gaps: | 5/68 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
||:|.|||.|:. |..|..||.|||..|:.:|:.|.||||...|.:||..:::.| |:.|||
Rat 366 PKRPPSAFFLFC-SEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKA----AKLKEK 425
Fly 73 LKQ 75
.::
Rat 426 YEK 428
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.