DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmg-4

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_498633.1 Gene:hmg-4 / 176052 WormBaseID:WBGene00001974 Length:697 Species:Caenorhabditis elegans


Alignment Length:116 Identity:36/116 - (31%)
Similarity:58/116 - (50%) Gaps:20/116 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            ||:..||:|.|..:: |..:| |..| ||.:|:.|||..|:.|:.:||..|:|.|....:.|:::
 Worm   556 PKRATSAYMQWFLAS-RNELK-EDGD-SVADVAKKGGAKWKTMSSDDKKKWEEKAEEDKSRYEKE 617

  Fly    73 LKQW--NFPKEHRFSDTQCICSSNTNQCPTLFVYDTMDDSMTPICRKCLSK 121
            :|::  |.|.    |.:....||.|::           .|..|...|.:||
 Worm   618 MKEYRKNGPP----SSSSKPSSSKTSK-----------KSSGPSSSKAISK 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 24/65 (37%)
Herpes_U55 <55..>116 CDD:253772 14/62 (23%)
hmg-4NP_498633.1 SSrecog 75..285 CDD:281523
PH2_SSRP1-like 332..429 CDD:270051
HMGB-UBF_HMG-box 556..619 CDD:238686 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.