DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmg-1.2

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:69 Identity:20/69 - (28%)
Similarity:41/69 - (59%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            ||:.:|||..: :...|..|:|.|||:.|.:|:.:.|:||:.:..|.|.::::.|......|.::
 Worm   135 PKRALSAFFFY-SQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADE 198

  Fly    73 LKQW 76
            ::.:
 Worm   199 MRNY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 20/67 (30%)
hmg-1.2NP_001380090.1 HMG-box_HMGB_rpt1 44..112 CDD:438794
HMG-box_SF 124..202 CDD:469606 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.