DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and sox10

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_571950.1 Gene:sox10 / 140616 ZFINID:ZDB-GENE-011207-1 Length:485 Species:Danio rerio


Alignment Length:75 Identity:21/75 - (28%)
Similarity:40/75 - (53%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73
            |:||:|||:|..:..|| :..::|.....|:|...|::||.:.:.||..:.|.|.....::|:..
Zfish   109 KRPMNAFMVWAQAARRK-LADQYPHLHNAELSKTLGKLWRLLNETDKRPFIEEAERLRKQHKKDY 172

  Fly    74 KQWNFPKEHR 83
            .::.:....|
Zfish   173 PEYKYQPRRR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 20/66 (30%)
sox10NP_571950.1 Sox_N 13..97 CDD:463586
HMG-box_SoxE 107..181 CDD:438840 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.