DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and HMGB4

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_660206.2 Gene:HMGB4 / 127540 HGNCID:24954 Length:186 Species:Homo sapiens


Alignment Length:85 Identity:27/85 - (31%)
Similarity:48/85 - (56%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKH---IKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
            |::|.|:|:|:.    :.|   :|.|:|::||.:|:...|:||....|.:|..:::......|:|
Human    93 PRRPPSSFLLFC----QDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKY 153

  Fly    70 KEKL----KQWNFPKEHRFS 85
            .|:|    ||.|..|::|.|
Human   154 FEELELYRKQCNARKKYRMS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 22/74 (30%)
HMGB4NP_660206.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..98 2/4 (50%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.