DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and HMGB4

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001366230.1 Gene:HMGB4 / 127540 HGNCID:24954 Length:186 Species:Homo sapiens


Alignment Length:85 Identity:27/85 - (31%)
Similarity:48/85 - (56%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKH---IKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
            |::|.|:|:|:.    :.|   :|.|:|::||.:|:...|:||....|.:|..:::......|:|
Human    93 PRRPPSSFLLFC----QDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKY 153

  Fly    70 KEKL----KQWNFPKEHRFS 85
            .|:|    ||.|..|::|.|
Human   154 FEELELYRKQCNARKKYRMS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 21/72 (29%)
Herpes_U55 <55..>116 CDD:253772 11/35 (31%)
HMGB4NP_001366230.1 HMG-box 8..78 CDD:412149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..98 2/4 (50%)
HMG-box 93..158 CDD:238037 20/68 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.