DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and LOC108352140

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_017453216.1 Gene:LOC108352140 / 108352140 RGDID:11427469 Length:168 Species:Rattus norvegicus


Alignment Length:68 Identity:24/68 - (35%)
Similarity:41/68 - (60%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKH---IKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
            |:||.|:|:|:    .:.|   ||.:||:::|.:|:...|.||...::.|||.::|.|....|:|
  Rat    93 PRKPPSSFLLF----SQDHFDEIKEQHPNWTVGQVAKAAGRMWARCSEADKIPYEERAAVLRAKY 153

  Fly    70 KEK 72
            .|:
  Rat   154 LEE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 24/68 (35%)
LOC108352140XP_017453216.1 HMG-box_SF 8..76 CDD:469606
HMG-box_HMGB_rpt2 95..161 CDD:438795 23/66 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.