DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and HMG20B

DIOPT Version :9

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens


Alignment Length:69 Identity:16/69 - (23%)
Similarity:35/69 - (50%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            ||.|::.::.::|.. |:.|:..|||....|::...|..|..:...:|..:.:.|.....:|.::
Human    70 PKAPVTGYVRFLNER-REQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKE 133

  Fly    73 LKQW 76
            |:.:
Human   134 LRAY 137

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 15/65 (23%)
Herpes_U55 <55..>116 CDD:253772 4/22 (18%)