DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT1 and AT1G67760

DIOPT Version :10

Sequence 1:NP_524450.2 Gene:CCT1 / 42649 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_176942.2 Gene:AT1G67760 / 843101 AraportID:AT1G67760 Length:120 Species:Arabidopsis thaliana


Alignment Length:111 Identity:26/111 - (23%)
Similarity:50/111 - (45%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEH-PAAK 76
            ||..|...:..|:.|..:::.|::|||||.|::|....|:.::: ......:|.|:.:.. |.|.
plant    22 TRLKGIDAQKANISAGKAVARILRSSLGPKGMEKKCFKDLTEMS-PYVSFFLLNLISLRSIPMAL 85

  Fly    77 VLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIIS 122
            .|           ..|...:..|:|  :|:.....::..|.|.:|:
plant    86 AL-----------NSGLQPIETLSA--VKSQQIKERRTFHSTGLIA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 TCP1_alpha 12..538 CDD:239451 26/111 (23%)
AT1G67760NP_176942.2 chaperonin_like 2..>55 CDD:351886 12/32 (38%)
chaperonin_like <78..107 CDD:351886 7/41 (17%)

Return to query results.
Submit another query.