powered by:
Protein Alignment CCT1 and VKORC1L1
DIOPT Version :9
Sequence 1: | NP_524450.2 |
Gene: | CCT1 / 42649 |
FlyBaseID: | FBgn0003676 |
Length: | 557 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001271271.1 |
Gene: | VKORC1L1 / 154807 |
HGNCID: | 21492 |
Length: | 177 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 31/70 - (44%) |
Gaps: | 12/70 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 VLIPG-YALNCTIASQQMPKKIVNAKIACLDFSLQKTK-MKMGVQVLINDPDKLEAIRARELDIT 274
|.:|| :::.|.........:.|.|::....:.||.|. ::.| |||..|.:..:|
Human 87 VPVPGLHSVLCAEGVLHHLHRHVRAELPSSHYQLQTTSLLERG----------LEAAAATQAGLT 141
Fly 275 KERIN 279
.:|::
Human 142 PDRLH 146
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CCT1 | NP_524450.2 |
TCP1_alpha |
12..538 |
CDD:239451 |
16/70 (23%) |
VKORC1L1 | NP_001271271.1 |
VKOR |
18..>65 |
CDD:321633 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0459 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.