DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT1 and VKORC1L1

DIOPT Version :9

Sequence 1:NP_524450.2 Gene:CCT1 / 42649 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001271271.1 Gene:VKORC1L1 / 154807 HGNCID:21492 Length:177 Species:Homo sapiens


Alignment Length:70 Identity:16/70 - (22%)
Similarity:31/70 - (44%) Gaps:12/70 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 VLIPG-YALNCTIASQQMPKKIVNAKIACLDFSLQKTK-MKMGVQVLINDPDKLEAIRARELDIT 274
            |.:|| :::.|.........:.|.|::....:.||.|. ::.|          |||..|.:..:|
Human    87 VPVPGLHSVLCAEGVLHHLHRHVRAELPSSHYQLQTTSLLERG----------LEAAAATQAGLT 141

  Fly   275 KERIN 279
            .:|::
Human   142 PDRLH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT1NP_524450.2 TCP1_alpha 12..538 CDD:239451 16/70 (23%)
VKORC1L1NP_001271271.1 VKOR 18..>65 CDD:321633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.