DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and PFD5

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_197720.1 Gene:PFD5 / 832393 AraportID:AT5G23290 Length:151 Species:Arabidopsis thaliana


Alignment Length:149 Identity:44/149 - (29%)
Similarity:88/149 - (59%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQ 70
            |:.::.||   .|:..:||..:|::.:.|:..:||||:.:.....:...:..||.......:.::
plant     3 SSSSRGEM---EKMGIDQLKALKEQADLEVNLLQDSLNNIRTATVRLDAAAAALNDLSLRPQGKK 64

  Fly    71 ILVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTR 135
            :|||||:|:||||.:.:.::.::||||||:|||.::..|||.:|::..::...:::.::..:|..
plant    65 MLVPLTASLYVPGTLDEADKVLVDIGTGYFIEKTMDDGKDYCQRKINLLKSNFDQLFEVAAKKKS 129

  Fly   136 FYNSVMSVLE--MKQAAAA 152
            ..:....||:  :||..||
plant   130 VADEAGMVLQAKVKQLTAA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 37/129 (29%)
PFD5NP_197720.1 TIGR00293 15..141 CDD:129394 36/125 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3182
eggNOG 1 0.900 - - E1_COG1730
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1972
Inparanoid 1 1.050 85 1.000 Inparanoid score I2338
OMA 1 1.010 - - QHG54008
OrthoDB 1 1.010 - - D1449403at2759
OrthoFinder 1 1.000 - - FOG0005548
OrthoInspector 1 1.000 - - oto4162
orthoMCL 1 0.900 - - OOG6_101532
Panther 1 1.100 - - LDO PTHR12674
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3967
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.