DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and PFD5

DIOPT Version :10

Sequence 1:NP_651053.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_197720.1 Gene:PFD5 / 832393 AraportID:AT5G23290 Length:151 Species:Arabidopsis thaliana


Alignment Length:149 Identity:44/149 - (29%)
Similarity:88/149 - (59%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQ 70
            |:.::.||   .|:..:||..:|::.:.|:..:||||:.:.....:...:..||.......:.::
plant     3 SSSSRGEM---EKMGIDQLKALKEQADLEVNLLQDSLNNIRTATVRLDAAAAALNDLSLRPQGKK 64

  Fly    71 ILVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTR 135
            :|||||:|:||||.:.:.::.::||||||:|||.::..|||.:|::..::...:::.::..:|..
plant    65 MLVPLTASLYVPGTLDEADKVLVDIGTGYFIEKTMDDGKDYCQRKINLLKSNFDQLFEVAAKKKS 129

  Fly   136 FYNSVMSVLE--MKQAAAA 152
            ..:....||:  :||..||
plant   130 VADEAGMVLQAKVKQLTAA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_651053.1 Prefoldin_5 23..146 CDD:467473 36/124 (29%)
coiled coil 23..62 CDD:467473 10/38 (26%)
coiled coil 106..146 CDD:467473 7/41 (17%)
PFD5NP_197720.1 Prefoldin_5 17..140 CDD:467473 36/122 (30%)
coiled coil 17..56 CDD:467473 10/38 (26%)
coiled coil 100..140 CDD:467473 7/39 (18%)

Return to query results.
Submit another query.