DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and pfdn5

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001104665.1 Gene:pfdn5 / 568182 ZFINID:ZDB-GENE-030131-6858 Length:153 Species:Danio rerio


Alignment Length:154 Identity:59/154 - (38%)
Similarity:102/154 - (66%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPLTSS 78
            ::||:||..||..:|.:.:||...:..|::.|...|.||..:|::|.....:.|.:::|||||||
Zfish     3 VNLTELSLPQLEGLKTQLDQETEFLSSSIAQLKVVQTKYVEAKDSLNVLNKSNEGKELLVPLTSS 67

  Fly    79 MYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSV 143
            |||||::.|::..::|:||||::||::|..|::|||:::::.:|||||:....:|.....:|:.|
Zfish    68 MYVPGKLHDVDHVLVDVGTGYFVEKNVEDGKEFFKRKIDFLTKQIEKIQPALQEKYAMKQAVVEV 132

  Fly   144 LEMKQAAAAKLQSQQQSQPAVTQS 167
            :.||   ..:|.|||.||...|::
Zfish   133 MNMK---LQQLHSQQASQSGTTKA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 48/127 (38%)
pfdn5NP_001104665.1 TIGR00293 10..134 CDD:129394 46/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595472
Domainoid 1 1.000 103 1.000 Domainoid score I6756
eggNOG 1 0.900 - - E1_COG1730
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1972
Inparanoid 1 1.050 121 1.000 Inparanoid score I4740
OMA 1 1.010 - - QHG54008
OrthoDB 1 1.010 - - D1449403at2759
OrthoFinder 1 1.000 - - FOG0005548
OrthoInspector 1 1.000 - - oto39685
orthoMCL 1 0.900 - - OOG6_101532
Panther 1 1.100 - - LDO PTHR12674
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R908
SonicParanoid 1 1.000 - - X3967
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.