DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and Pfdn5

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_081320.2 Gene:Pfdn5 / 56612 MGIID:1928753 Length:154 Species:Mus musculus


Alignment Length:153 Identity:55/153 - (35%)
Similarity:96/153 - (62%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPL 75
            ::.|::|:|:..||..:|.:.:||:..:..|::.|...|.||..:|:.|.....:.|.:::||||
Mouse     2 AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPL 66

  Fly    76 TSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSV 140
            ||||||||::.|:...:||:|||||:||..|.:||:|||:::::.:|:|||:....:|.....:|
Mouse    67 TSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAV 131

  Fly   141 MSVLEMKQAAAAKLQSQQQSQPA 163
            |.::..|......|.:.|.:..|
Mouse   132 MEMMSQKIQQLTALGAAQATVKA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 49/127 (39%)
Pfdn5NP_081320.2 TIGR00293 12..138 CDD:129394 48/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849694
Domainoid 1 1.000 103 1.000 Domainoid score I6795
eggNOG 1 0.900 - - E1_COG1730
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1972
Inparanoid 1 1.050 116 1.000 Inparanoid score I4812
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54008
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005548
OrthoInspector 1 1.000 - - oto92935
orthoMCL 1 0.900 - - OOG6_101532
Panther 1 1.100 - - LDO PTHR12674
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R908
SonicParanoid 1 1.000 - - X3967
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.